PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 288aa    MW: 31730.9 Da    PI: 6.6809
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030029genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.13.7e-33158215259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYGqK vk+s+fprsYYrCt  +C vkk+vers++dp++v++tYeg+H h+
  DCAR_030029 158 EDGYRWRKYGQKAVKNSPFPRSYYRCTNGKCLVKKRVERSSDDPSTVITTYEGQHSHH 215
                  8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-33142215IPR003657WRKY domain
SuperFamilySSF1182901.7E-28149215IPR003657WRKY domain
PROSITE profilePS5081130.354152217IPR003657WRKY domain
SMARTSM007741.1E-38157216IPR003657WRKY domain
PfamPF031063.2E-26158215IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDESDKLDPP TDFSPESSWT LGADPANMYN TFFPDSDFGW NLHPENPHNF ADFDRIDHNF  60
AGSSTFPAIT RVPHENPSSN NIDTVLPEME AQSGPAADNN QSVSSSTSED LPEKSTASAS  120
SADIATPETA IKEKKKGAKR IRQPRFAFMT KSDIDNLEDG YRWRKYGQKA VKNSPFPRSY  180
YRCTNGKCLV KKRVERSSDD PSTVITTYEG QHSHHAIGFP RGSPPGFITH QGLISQHFYP  240
PGIQFPAPGR QQVSNSRLIQ PRQLISAARE SPTDGLLGDI VHPGGRT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-24145214271WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316097.25e-84hypothetical protein POPTR_0010s16760g
SwissprotQ9C9839e-67WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLB9HXK96e-84B9HXK9_POPTR; Uncharacterized protein
STRINGPOPTR_0010s16760.12e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80312228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-64WRKY DNA-binding protein 57